PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013619892.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Trihelix
Protein Properties Length: 960aa    MW: 107099 Da    PI: 7.0622
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013619892.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix26.61.6e-081812322273
        trihelix  22 rrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrts 73 
                     +rgk ++ + +ev++++ ++g++r +k    kw+n+ ++++k++e+ek+   
  XP_013619892.1 181 GRGKTRAEKDREVAEYLNRKGVNRDSKVAGTKWDNMLGEFRKVNEWEKGADR 232
                     2445999999**************************************8633 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138371.1E-7145232No hitNo description
CDDcd001801.43E-9808949No hitNo description
Gene3DG3DSA:1.10.510.104.7E-5808912No hitNo description
SuperFamilySSF561121.38E-13808949IPR011009Protein kinase-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 960 aa     Download sequence    Send to blast
MGETTKGDAT KPSPNQISPP KDSSLDHQTL NPSLLHHQHQ SFLSSPIFIP TVSSPGAPVI  60
PKRPRFSSSG GLSPPQWRAL PSPSTVPTAS TISSLPSPST AVIAASSTET AGSSPLVQEA  120
TNTEKQQPET ESFQHKFRKG KYVSPVWKPN EMLCLARAWK VQYQNQRTGS GSGSGSGSGE  180
GRGKTRAEKD REVAEYLNRK GVNRDSKVAG TKWDNMLGEF RKVNEWEKGA DRERYGKSYF  240
RLSPYERKQH QLPASFDEEV YNELALFIGP RVRAPTISRS VSGGATADVT LTPPSAETLP  300
PPLHPPVMTS RDDDINNNPI TSIGRGKRLA LSTVGDDHPQ YPYSSNIARG SGLFSNRSLY  360
YNPSCERIPS SSSSSSLKDL RRVGKIRLTW EESVNLWAEE GEVDYGRIRV CGSSFLNADE  420
LTYLDDSMVA STMESFEDGP LKGFSLDKFI SGQHLKVFGR QKSTSSSAPP LSVNMAFDRA  480
QLPHSEHIHK SISTLEFQDP SEHCLSKLRV PAGNLPSITE LARYLQEPPP ENLRFPLRLD  540
VYNDLPLGKE LFFSTSSTEL LDCRAITYDI LGPIMSPLNM GFVIFNKDSL IPLWEDCVNR  600
MVSKFCEMVV LRKPDSSSCV ENVQDQWPNV MGFVKGFGLW RGEEVDKVRE GAPDPSSLLV  660
EKILWSYNDL PYILGYHAKG LTVTFCSLSR SSHDRVTCTD LYSFDVSSPS DRIKALVPCY  720
RLASLLPLLA DQCTASRLCY NDYERINHGD LLTEMTPHTV TKYYSSKRKW NVTKGIYDFL  780
DQRIPHAEHL DRASEKDLSL SFKPRGIRVK PLNVDQLIES LMCVTRALVA LHDLSFMHRN  840
MGWENVMKSE TTTTSNAEWF VCGFEEAAES PQLNPHRLAA QEEEEERGRH APEMERGLHA  900
VKVDVWGVGY MIKTCGVSNV PKMLRELQGK CLEPNQENRP TAADCFHHLL QVQPAVPSSY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619892.10.0PREDICTED: uncharacterized protein LOC106326463
TrEMBLA0A0D3AMW30.0A0A0D3AMW3_BRAOL; Uncharacterized protein
STRINGBra022563.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83561624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33550.11e-08Trihelix family protein